Het overzicht van de statistiek van de arbeidsmarkt in

OrganisatieWerkt operationeel in de zaal en hangt hiërarchisch af van de Assistant Restaurant Manager en de zaakvoerderDoelService naar de klanten toeOnthalen en bedienen van de klanten, bestellingen opnemen.Opruimen van de zaal en in orde houden van de toiletten.Respecteren van interne kwaliteitsnormen en hygiëne standaards.HoofdtakenKlanten onthalen aan de toonbank en drive, indien van toepassingBestellingen opnemen, en registreren in de kassaBestellingen klaarzetten op een dienblad of verzamelen in draagtassen om mee te nemenBetaalmiddelen ontvangen en afrekenen rekening houdende met instructies van speciale actiesIndien noodzakelijk klanten begeleiden (in rolstoel, met kleine kinderen,…)Frieten bakken en salades samenstellenInstaan voor het onderhoud van werkpost, apparatuur en materiaalInstaan voor algemeen onderhoud: tafels afruimen, zaal in orde houden, alsook de toiletten en de parkingProfielOpleiding en ervaring zijn niet vereistKlantvriendelijkFlexibel: bereid te werken op zaterdag, zondag en ‘s avondsDynamisch, leergierig en werklustigTeamworkStressbestendigAanbodBoeiende, vaste job met reële doorgroeimogelijkheden.Opleiding on the job

We help the world run better Our company culture is focused on helping our employees enable innovation by building breakthroughs together. How? We focus every day on building the foundation for tomorrow and creating a workplace that embraces differences, values flexibility, and is aligned to our purpose-driven and future-focused work. We offer a highly collaborative, caring team environment with a strong focus on learning and development, recognition for your individual contributions, and a variety of benefit options for you to choose from.

We help the world run better Senior Digital Supply Chain Process Architect COMPANY DESCRIPTION: As market leader in enterprise application software, SAP helps companies of all sizes and industries innovate through simplification. From the back office to the boardroom, warehouse to storefront, on premise to cloud, desktop to mobile device – SAP empowers people and organizations to work together more efficiently and use business insight more effectively to stay ahead of the competition. SAP applications and services enable customers to operate profitably, adapt continuously, and grow sustainably. ROLE DESCRIPTION: Founded in 1972, SAP is the world’s leading provider of enterprise applications, analytics, and mobility with over 170,000 customers around the world. SAP is currently seeking an experienced Business Processes Senior Consultant. The focus of an SAP Architect’s expertise is typically in the planning and design phases of a Digital Transformation Project based on SAP S/4 and other SAP Solutions. However, it could also be leveraged on strategic corporate initiatives such as business process improvement initiatives or developing ongoing architectural governance processes. The engagement model of an Architect is not strictly limited to the planning/design phases, but may also span the build and operations phases to ensure proper implementation and operationalization of the designed business solutions. This will be related S/4 HANA projects making sure the transition from existing processes and systems to the S/4 HANA world (cloud, on-premise or hybrid) are as efficient, effective and valueadding as possible. EXPECTATIONS AND TASKS: Focus of Business Process Architects On the basis of the client’s scope, requirements and business strategy within a certain area, a Business Process Architect is able to Review client as-is processes (typically in SAP ECC) and create the target operating model based on S/4HANA standard and best practises with the high-level to-be process model and delta descriptions. Design detailed industry and customer specific to-be processes and the solution design based on process requirements, application and system landscape Business Process Architects evaluate customer requirements, map them to business processes, functional and solution architectures and ensure a proper implementation from an solution architecture point of view. For this they: Design detailed end-to-end industry-specific / corporate customer to-be processes Identify the appropriate end-to-end solution portfolio options and recommendations Identify solution gaps and develop gap closure options Design the end-to-end functional landscape and solution design, including the functional integration points, applicable standards and governance Leadership. Business Process Architects can independently lead or execute complex assignments and deliverables. They can coach project and team members on solution architectural topics and they have content knowledge to propose functional solutions in their domain. Advisory / Delivery. Tasks in Detail Plan Analyze and validate the client’s business and IT requirements, considering where applicable his business strategy and business drivers, relevant industry trends, key pain points, challenges and priorities with focus on your area of expertise in Supply Chain, LE, Procurement and/or Sales. Define the high level end-to-end industry-specific / corporate customer business processes (e.g. Process Levels 1-3) and derive the lower level business processes (e.g. Process Levels 4-5) Model and ensure the alignment of the business processes with the overall business model, the business objectives and requirements and including, as applicable, all relevant management, operational and support processes with the corresponding events, goals, inputs, outputs, information and resources. Identify the appropriate end-to-end solution portfolio, considering all relevant SAP solution and service offerings, such as Best Practices, Preferred Success a.o. with focus on leverage of SAP reusable content. Identify solution gaps, develop gap closure options such as the inclusion of components from the Industry cloud or customer-specific developments. Identify cross-process and cross-solution integration points between SAP solutions, legacy systems, ISV components and BTP and lead the orchestration across the various software and service components of the end-to-end solutionl Work with the Technical Architect on technical integration and infrastructure planning Where applicable, define or take part in defining architectural standards, principles and the governance framework and processes to manage stakeholder decisions and safeguard the integrity of the solution architecture through the implementation phase Build Provide direction to or be a part of the implementation teams during solution realization and work as intermediary across the local, near shore and offshore delivery streams and the different solution domains to ensure overall alignment Participate, as necessary, in training, system setup, testing, documentation and maintenance support activities Where applicable, lead or take part in the architectural governance function/processes during the implementation (ensure the ongoing alignment of business architecture, functional architecture and technical architecture from a functional/solution perspective), Keep track and coordinate the resolution of integration issues When required, analyze changes necessary to the solution architecture triggered by changes in business requirements, processes or technical requirements, develop options to incorporate the changes and take/facilitate the appropriate decisions Lead solution architecture related project quality management tasks such as peer and quality reviews of specifications, design documents and code reviews Take responsibility from time to time as team lead and support line manager(s) in people development tasks Run If requested, support value tracking and reporting after go-live, in particular in view of the customer value realized by the proposed business processes and corresponding solution architecture design Drive business development, consumption and adoption of all solutions Generate and support license and services sales cycles by providing architectural, solution and industry expertise, in alignment with SAP’s service strategy Thought Leadership / Knowledge Management Lead and contribute as an expert to related KM communities Identify opportunities for service productization and drive the definition and creation of pre-defined services in the respective area of expertise Actively follow and share developments and trends regarding new SAP and complementary partner service and solution offerings, industry trends and other topic areas relevant for the solution architecture domain WORK EXPERIENCE: Work Experience Generally eight or more years of experience in process implementation in customer facing roles related to solution architecture and implementation topics Functional & Industry Experience Expert in Digital Supply Chain, Sales, Procurement and/or LE, in at least one Industry and familiar with the relevant industry trends and business strategies and models, industry specific business processes, challenges, business drivers/pain points and related best-practice solution architectures Expert in at least two functional topics within the relevant solution area, preferable on S4 level in cloud solutions. Deep understanding of SAP’s solution and service offerings including LoB cloud solutions, S4HANA ERP, pre-defined services and implementation models Can leverage deep knowledge of business domain during problem definition, solution architecture and design, implementation and user adoption phases of projects and can communicate this at client C-Level Expert knowledge in functional integration and cross-solution issues Expert in applying methods of process and solution modeling based on SAP and non-SAP solutions in one or more industries Has comprehensive track record and experience with complex implementation projects , including the coordination and decision facilitation of process and architecture related issues, can effectively moderate between Client, Partners and SAP, Business and IT Active member of the SAP Knowledge communities EDUCATION AND QUALIFICATION / SKILLS AND COMPETENCIES: Bachelor, Masters or equivalent degree English Fluent plus at least one of the National Languages. Product knowledge SAP standard solution and service offerings SAP Next Generation solutions and services Standards Architectural standards and methodologies (such as EA, TOGAF, FEA, Gartner Methodology, ITIL) Where applicable, project management methodologies and standard (such as LACE and SAP Activate, PMI/PMBOK, PRINCE2 etc.) Soft skills as listed under competencies, but especially: communication (senior level), presentation, facilitation & negotiation, leadership & management Familiarity with the ADM delivery models (expert-based, design-based, assemble to order, industrialized)

Company Description Devoteam is a leading consulting firm focused on digital strategy, tech platforms and cybersecurity. By combining creativity, tech and data insights, we empower our customers to transform their business and unlock the future. With 25 years’ experience and 10,000 employees across Europe, the Middle East and Africa, Devoteam promotes responsible tech for people and works to create better change. Join our global community of exceptional talents at Devoteam, where you’ll collaborate with multidisciplinary teams of data specialists, business consultants, solution architects, security experts, cloud engineers, developers, and more across over 20 countries in the EMEA region. As a member of our team, you’ll have the opportunity to work with the world’s leading partners, including AWS, Google Cloud, Microsoft, and ServiceNow, driving innovation and advancing your career. Job Description If you like these keywords you’ll love this role: #infra-as-code #cicd #landingzone #cloud #azure #innovate Do you believe everything can be automated? We need Azure Cloud Engineers that can define and implement Cloud Foundations, Landing Zones and Infrastructure as Code solutions. You’ll be part of our multidisciplinary M Cloud team, where DevOps, Agile, Data, Security, Cloud & Software Engineering experts all work together to create exciting solutions based on Microsoft technologies. In this role you work with your team on projects such as setting up CI/CD from scratch, being part of development, data or platform teams, building Cloud platforms, modernizing/migrating environments and much more. Together, we empower leading enterprises and governments to bring positive change to the world with cutting-edge technology and digital strategies. Where you will work: #techies in our minds, #creatives in our hearts, #change in our DNA. You’ll be part of a bunch of Tech Enthusiasts in a fail-safe culture where everyone, from bright talents to experienced rockstars, is encouraged to continuously innovate and grow. We are a community that is proud of who you are and helps you to become who you want to be. Our dietary constraints: we’re allergic to unnecessary hierarchies and excessive processes. At Devoteam, the only constant is change.  Qualifications For this position, we’re looking for all seniority levels . [Must-have] You have hands-on experience with Azure DevOps or Jenkins. [Must-have] You’re known with ARM, Bicep, Azure Repos / Github, Azure Pipelines and Azure Boards. [Must-have] You like to drive change and bring creative tech ideas to life. [Nice-to-have] You have experience with Terraform, Docker, Kubernetes, AKS... [Nice-to-have] You are familiar with Cloud Adoption Framework (CAF), ... [Nice-to-have] You know how to work Agile and you are a believer of IaC and DevOps. [Nice-to-have] You’re either proficient in Dutch or French (or you want to learn) and fluent in English. [Bonus-points] Azure certified (or willing to obtain). Certifications in scope: AZ-104, AZ-400, AZ-500, AZ-700, SC-300. If you do not feel fully confident that you meet the requirements above, please don’t worry. Just apply. Together we’ll discover what you can bring to the table, in which role you would fit best and how you could potentially grow at Devoteam. Additional Information Why choose us? Cutting-edge Technology : Embrace the latest advancements in IT and digital technologies as we constantly innovate to stay ahead of the competition. Our commitment to adopting state-of-the-art tools and methodologies ensures that you'll work on projects at the forefront of the industry. Entrepreneur mindset : We value our people over processes. You will develop and grow in an agile and ambitious company where it’s okay to take risks, make mistakes and change plans to find transformative solutions. At the same time, you will learn from the best, building relationships and skills that will last your entire career. Endless Learning Opportunities : We value personal and professional growth. Through workshops, conferences, and certifications, we offer the resources needed to expand your skill set and reach new heights in your career. Connect with amazing people : You will become part of a network of +10,000 Devoteamers spread over 20 countries. Collaborative Culture : Teamwork is at the heart of our organisation. You'll be working side by side with a diverse group of IT experts who share your passion for excellence and will inspire you to think outside the box. Impactful Projects : Tackle real-world challenges that matter! From revolutionising business processes to developing innovative solutions, you'll have the chance to make a genuine and positive impact on our clients and the community. Work-Life Balance : We believe in a healthy work-life balance, ensuring that you have time to unwind, pursue your hobbies, and spend quality time with loved ones. Inspiring and eco-friendly workplace : We just moved to an amazing new building. We believe an inspiring workspace fuels creativity and fosters a positive work culture, allowing our employees to reach their full potential. The Wings building is also designed with eco-friendly features and energy-efficient systems. By reducing our ecological footprint, we are contributing to a greener future and aligning our business practices with our environmental values. The building is also very easily accessible by public transportation.  Competitive package : We offer a competitive salary package with additional benefits like a company car, smartphone, medical insurance, pension plan, net allowance, laptop, meal vouchers, etc. We review our salary grid twice a year to ensure we are in line with the market. At Devoteam, we combine strong values – respect, frankness, ambition, entrepreneurship & collaboration - with a fun environment that empowers you to innovate and succeed. > > > Does all this sound compelling to you? Go for it and click that apply button!

About DS Smith DS Smith is a leading provider of sustainable fibre-based packaging worldwide, which is supported by recycling and papermaking operations. We play a central role in the value chain across sectors including e-commerce, fast moving consumer goods and industrials. We are committed to leading the transition to the circular economy, while delivering more circular solutions for our customers and wider society – replacing problem plastics, taking carbon out of supply chains and providing innovative recycling solutions. About the role  As a Commercial Business Analyst, you will support the Central accounts management team with the back office work related to tenders, profitability, demand forecasting and all other business analytics. Key Responsibilities Coordinate the monthly volume forecast process  Apply Price indexation Support all tender activity, specifically the analysis of the tender to ensure information is available for updating the CRM, as well as coordination of the regional price submissions Maintain the integrity of the Contracts Database and ensure metadata is up to date and accessible Calculate monthly the likely volume forecast for the next 24 months for central accounts and validate with the account managers. Work with the Sales team to ensure each of their Customers have an account plan articulating clearly and sensibly the plan of action to maximise profitability. Store and make accessible all the relevant latest contracts for our central accounts. The responsibility also includes the extraction of key information or data (metadata) from the contracts to support the efficient management of the accounts (i.e. Indexation and payment terms).  Liaise with the regions (tenders managers network) to ensure each Customer tender’s Request for Quote (RFQ) are completed fully and on time. About You Bachelor`s degree, preferably in Finance, or equivalent experience Analysis skills using Excel are essential, Power BI would be an advantage Excellent communication skills Ability to adhere to strict deadlines Knowledge of the Corrugating/Packaging industry is preferable Benefits Competitive salary Discretionary bonus 25 days holiday plus bank holidays  Pension scheme, life assurance and income protection Employee Assistance Programme Employee Discounts Cycle to work scheme. Location: London (Paddington) or Brussels (Diegem) - hybri

Company Description Devoteam is a leading consulting firm focused on digital strategy, tech platforms and cybersecurity. By combining creativity, tech and data insights, we empower our customers to transform their business and unlock the future. With 25 years’ experience and 10,000 employees across Europe, the Middle East and Africa, Devoteam promotes responsible tech for people and works to create better change. Join our global community of exceptional talents at Devoteam, where you’ll collaborate with multidisciplinary teams of data specialists, business consultants, solution architects, security experts, cloud engineers, developers, and more across over 20 countries in the EMEA region. As a member of our team, you’ll have the opportunity to work with the world’s leading partners, including AWS, Google Cloud, Microsoft, and ServiceNow, driving innovation and advancing your career. Job Description Mission Take on a prominent role in the architecture and design of web solutions. Work with the wider development team to scope out and develop new web applications for existing services. Develop a flexible and well-structured back end architecture. Participate in code reviews, testing, and quality assurance processes to ensure high-quality code Help identify, escalate, resolve any technical issues and problems that might occur. Participate in code reviews, testing, and quality assurance to meet project goals and timelines. Provide technical guidance to junior developers and communicate effectively with clients and stakeholders. Qualifications Profile Strong analytical and problem-solving skills Good understanding of software development lifecycle management. Good understanding of security concepts. Good understanding of software testing principles. Good understanding of software design patterns and principles Strong communication skills and ability to clearly explain technical concepts to non-technical stakeholders Willingness to keep up to date on innovative development frameworks and cloud technologies by following trainings, courses and certifications Fluency in Dutch or French and English Technical Requirements Strong knowledge of the Python programming language and its core concepts such as object-oriented programming, functional programming and data structures. Experience with popular Python web frameworks such as Django, Flask, or Pyramid. Experience with web frameworks such as Django REST framework or Flask-RESTful. Familiarity with databases and SQL, as well as ORM (Object-Relational Mapping) libraries such as SQLAlchemy or Peewee. Experience with version control systems such as Git, SVN, or Mercurial Experience with unit testing and end-to-end testing frameworks such as unittest or pytest. Understanding of security best practices and implementing security features such as authentication and authorization. Understanding of web services, such as REST or SOAP and related technologies like JSON or XML. Experience with managing and optimizing performance and scalability of the backend systems. Assets Knowledge of other languages such as C++, Java or C#. Familiarity with data analysis and visualization libraries such as pandas, numpy and matplotlib. Experience with frontend development in Angular, React or VueJS. Knowledge of API specification standards like OpenAPI, AsyncAPI, or GraphQL. Understanding of message queueing systems such as RabbitMQ or Kafka. Knowledge of caching and search engines like Redis, Memcached or Elasticsearch. Familiarity with Agile development methodologies such as Scrum. Knowledge of CI/CD setup such as Jenkins or Gitlab CI. Understanding of software design patterns and architecture principles, such as Clean Software Architecture, Data Structures, Microservices, Event-Driven, MVC, and SOA Experience with CI/CD/DevOps/DevSecOps principles Understanding of software testing and quality assurance processes Understanding of security and compliance standards Familiarity with containerization and container orchestration technologies such as Docker and Kubernetes. Experience with cloud platforms like AWS, Azure, or GCP. Experience in multi-threaded, distributed, N-Tier applications. Additional Information Why choose us? Cutting-edge Technology : Embrace the latest advancements in IT and digital technologies as we constantly innovate to stay ahead of the competition. Our commitment to adopting state-of-the-art tools and methodologies ensures that you'll work on projects at the forefront of the industry. Entrepreneur mindset : We value our people over processes. You will develop and grow in an agile and ambitious company where it’s okay to take risks, make mistakes and change plans to find transformative solutions. At the same time, you will learn from the best, building relationships and skills that will last your entire career. Endless Learning Opportunities : We value personal and professional growth. Through workshops, conferences, and certifications, we offer the resources needed to expand your skill set and reach new heights in your career. Connect with amazing people : You will become part of a network of +10,000 Devoteamers spread over 20 countries. Collaborative Culture : Teamwork is at the heart of our organisation. You'll be working side by side with a diverse group of IT experts who share your passion for excellence and will inspire you to think outside the box. Impactful Projects : Tackle real-world challenges that matter! From revolutionising business processes to developing innovative solutions, you'll have the chance to make a genuine and positive impact on our clients and the community. Work-Life Balance : We believe in a healthy work-life balance, ensuring that you have time to unwind, pursue your hobbies, and spend quality time with loved ones. Inspiring and eco-friendly workplace : We just moved to an amazing new building. We believe an inspiring workspace fuels creativity and fosters a positive work culture, allowing our employees to reach their full potential. The Wings building is also designed with eco-friendly features and energy-efficient systems. By reducing our ecological footprint, we are contributing to a greener future and aligning our business practices with our environmental values. The building is also very easily accessible by public transportation.  Competitive package : We offer a competitive salary package with additional benefits like a company car, smartphone, medical insurance, pension plan, net allowance, laptop, meal vouchers, etc. We review our salary grid twice a year to ensure we are in line with the market. At Devoteam, we combine strong values – respect, frankness, ambition, entrepreneurship & collaboration - with a fun environment that empowers you to innovate and succeed. > > > Does all this sound compelling to you? Go for it and click that apply button!

Company Description Devoteam is a leading consulting firm focused on digital strategy, tech platforms and cybersecurity. By combining creativity, tech and data insights, we empower our customers to transform their business and unlock the future. With 25 years’ experience and 10,000 employees across Europe, the Middle East and Africa, Devoteam promotes responsible tech for people and works to create better change. Join our global community of exceptional talents at Devoteam, where you’ll collaborate with multidisciplinary teams of data specialists, business consultants, solution architects, security experts, cloud engineers, developers, and more across over 20 countries in the EMEA region. As a member of our team, you’ll have the opportunity to work with the world’s leading partners, including AWS, Google Cloud, Microsoft, and ServiceNow, driving innovation and advancing your career. Job Description Mission Take on a prominent role in the architecture and design of web solutions. Work with the wider development team to scope out and develop new web applications for existing services. Develop a flexible and well-structured front and back end architecture. Be responsible for work quality, ensuring it meets the technical standards for all client online output. Qualifications Profile Strong understanding of software design patterns and architecture principles. Understanding of AWS Well-Architected Framework and cloud-native software development principles. Strong analytical and problem-solving skills. Strong communication and collaboration skills. Strong focus on quality and best practices. Technical requirements Strong knowledge of AWS services such as EC2, S3, RDS, Lambda, and SQS. Strong expertise in at least one programming language such as Java, C#, Python, and JavaScript. Experience with IaC such as CloudFormation and Terraform is an added advantage. Experience with AWS security services such as IAM, KMS, and Security Groups. Knowledge of software development tools such as Git and JIRA. Experience with containerization and orchestration technologies such as Docker, Kubernetes and ECS/EKS. Experience with Serverless architecture and AWS Lambda, API Gateway, and DynamoDB. Experience with AWS Elasticsearch, Redshift, and Glue. Working knowledge of AWS services such as Container, RDS, Redis/ElastiCache. Experience with CI/CD tools like CodePipeline and CodeBuild or equivalent. In-depth experience in implementing Microservices and REST/SOAP APIs. Familiarity with Agile development methodologies such as Scrum. Assets Strong analytical and problem-solving skills. Strong communication and collaboration skills. Experience in multi-threaded, distributed, N-Tier applications. AWS Certifications like AWS Solutions Architect, AWS DevOps Engineer or AWS Developer. Additional Information Why choose us? Cutting-edge Technology : Embrace the latest advancements in IT and digital technologies as we constantly innovate to stay ahead of the competition. Our commitment to adopting state-of-the-art tools and methodologies ensures that you'll work on projects at the forefront of the industry. Entrepreneur mindset : We value our people over processes. You will develop and grow in an agile and ambitious company where it’s okay to take risks, make mistakes and change plans to find transformative solutions. At the same time, you will learn from the best, building relationships and skills that will last your entire career. Endless Learning Opportunities : We value personal and professional growth. Through workshops, conferences, and certifications, we offer the resources needed to expand your skill set and reach new heights in your career. Connect with amazing people : You will become part of a network of +10,000 Devoteamers spread over 20 countries. Collaborative Culture : Teamwork is at the heart of our organisation. You'll be working side by side with a diverse group of IT experts who share your passion for excellence and will inspire you to think outside the box. Impactful Projects : Tackle real-world challenges that matter! From revolutionising business processes to developing innovative solutions, you'll have the chance to make a genuine and positive impact on our clients and the community. Work-Life Balance : We believe in a healthy work-life balance, ensuring that you have time to unwind, pursue your hobbies, and spend quality time with loved ones. Inspiring and eco-friendly workplace : We just moved to an amazing new building. We believe an inspiring workspace fuels creativity and fosters a positive work culture, allowing our employees to reach their full potential. The Wings building is also designed with eco-friendly features and energy-efficient systems. By reducing our ecological footprint, we are contributing to a greener future and aligning our business practices with our environmental values. The building is also very easily accessible by public transportation.  Competitive package : We offer a competitive salary package with additional benefits like a company car, smartphone, medical insurance, pension plan, net allowance, laptop, meal vouchers, etc. We review our salary grid twice a year to ensure we are in line with the market. At Devoteam, we combine strong values – respect, frankness, ambition, entrepreneurship & collaboration - with a fun environment that empowers you to innovate and succeed. > > > Does all this sound compelling to you? Go for it and click that apply button!

Company Description Devoteam is a leading consulting firm focused on digital strategy, tech platforms and cybersecurity. By combining creativity, tech and data insights, we empower our customers to transform their business and unlock the future. With 25 years’ experience and 10,000 employees across Europe, the Middle East and Africa, Devoteam promotes responsible tech for people and works to create better change. Join our global community of exceptional talents at Devoteam, where you’ll collaborate with multidisciplinary teams of data specialists, business consultants, solution architects, security experts, cloud engineers, developers, and more across over 20 countries in the EMEA region. As a member of our team, you’ll have the opportunity to work with the world’s leading partners, including AWS, Google Cloud, Microsoft, and ServiceNow, driving innovation and advancing your career. Job Description As a Cloud Engineer your tasks can include, but are not limited to: work on cloud infrastructure in Microsoft, Google or Linux environments the analysis of network, storage products and solutions to decide which choice is optimal depending on the practical requirements of our customers building an architecture plan with detailed technical specifications including the necessary technological equipment to configure and realize this plan Qualifications Cloud Platforms: Deep knowledge of at least one major cloud service provider (AWS, Azure, Google Cloud Platform) and experience with cloud services management, including hybrid cloud configurations. Infrastructure as Code (IaC): Proficiency in using tools like Terraform, Ansible, Chef, or Puppet for automating the provisioning and management of cloud and on-premises resources. Networking: Strong understanding of networking principles and technologies (, DNS, TCP/IP, VPNs) especially in the context of connecting cloud and on-premises environments. Security: Knowledge of cloud security principles and technologies, including identity and access management (IAM), firewalls, and encryption, tailored to safeguarding hybrid environments. Containers and Orchestration: Experience with containerization and orchestration tools (Kubernetes, OpenShift) to manage applications across different environments. DevOps Practices: Familiarity with DevOps methodologies and tools for continuous integration and continuous deployment (CI/CD), and how they apply in hybrid cloud setups. Monitoring and Management: Proficiency in using monitoring and management tools (, Prometheus, Grafana) for overseeing applications and infrastructure across diverse environments. Programming and Scripting: Ability to write scripts and automate tasks using languages like Python, Bash, or PowerShell. Educational Background: A bachelor's degree in Computer Science, Information Systems, Engineering, or related fields is preferred. Certifications specific to cloud platforms (AWS Certified Solutions Architect, Microsoft Certified: Azure Administrator), Certified Kubernetes Administrator or RedHat Certified Specialist in OpenShift Administration are highly beneficial. Soft Skills: Problem-Solving Skills: Ability to troubleshoot and resolve technical issues efficiently. Collaboration and Communication: Strong interpersonal skills to work effectively with development and operations teams. Adaptability: Willingness to learn new technologies and adapt to changing environments. Attention to Detail: Precision in code and system configurations to ensure high-quality outcomes. Project Management: Basic project management skills to handle tasks, timelines, and deliverables. Experience: Hands-on experience in designing, deploying, and managing hybrid cloud environments, demonstrating a comprehensive understanding of both cloud and on-premises infrastructure. Proven track record of successful projects that involve complex cloud integration and migration tasks. Additional Information Why choose us? Cutting-edge Technology : Embrace the latest advancements in IT and digital technologies as we constantly innovate to stay ahead of the competition. Our commitment to adopting state-of-the-art tools and methodologies ensures that you'll work on projects at the forefront of the industry. Entrepreneur mindset : We value our people over processes. You will develop and grow in an agile and ambitious company where it’s okay to take risks, make mistakes and change plans to find transformative solutions. At the same time, you will learn from the best, building relationships and skills that will last your entire career. Endless Learning Opportunities : We value personal and professional growth. Through workshops, conferences, and certifications, we offer the resources needed to expand your skill set and reach new heights in your career. Connect with amazing people : You will become part of a network of +10,000 Devoteamers spread over 20 countries. Collaborative Culture : Teamwork is at the heart of our organisation. You'll be working side by side with a diverse group of IT experts who share your passion for excellence and will inspire you to think outside the box. Impactful Projects : Tackle real-world challenges that matter! From revolutionising business processes to developing innovative solutions, you'll have the chance to make a genuine and positive impact on our clients and the community. Work-Life Balance : We believe in a healthy work-life balance, ensuring that you have time to unwind, pursue your hobbies, and spend quality time with loved ones. Inspiring and eco-friendly workplace : We just moved to an amazing new building. We believe an inspiring workspace fuels creativity and fosters a positive work culture, allowing our employees to reach their full potential. The Wings building is also designed with eco-friendly features and energy-efficient systems. By reducing our ecological footprint, we are contributing to a greener future and aligning our business practices with our environmental values. The building is also very easily accessible by public transportation.  Competitive package : We offer a competitive salary package with additional benefits like a company car, smartphone, medical insurance, pension plan, net allowance, laptop, meal vouchers, etc. We review our salary grid twice a year to ensure we are in line with the market. At Devoteam, we combine strong values – respect, frankness, ambition, entrepreneurship & collaboration - with a fun environment that empowers you to innovate and succeed. > > > Does all this sound compelling to you? Go for it and click that apply button!

Viens rejoindre l’équipe IT grandissante d'un de nos clients!Un job étudiant pas comme les autres dans lequel tu seras partie intégrante de leur équipe IT ainsi que de leurs projets !Ta fonction polyvalente te permettra de travailler sur diverses missions te permettant également d’accroitre tes compétences tout en aidant les équipes internes.REQUIRED PROFILEWE OFFER

Where talented people find their placeUse your skills to make a positive difference in the worldWhat comes to mind when you think of PwC? Auditing? Tax? Accounting? Consulting? We’re all of those things - and so much more! PwC is your opportunity to learn with purpose, lead with heart, and make a positive impact on the world. Whether you want to delve into the fascinating and constantly changing tax landscape, go deep into the world of deals, or make a difference by solving problems - you can do it all here. Bring your talent to PwC and help us develop a lasting way to make a change for our clients. See how you can nurture your future with PwC, your career mentor, and discover how fulfilling being part of our community can be! REQUIRED PROFILEWho you areStudying for a bachelor's OR master's degree in Accountancy, Taxation, Law, (Applied) Economics, Business Engineering, Business Administration …;Team player with a sense of initiative and a critical and analytical mind;Communicative, eager to learn and looking to develop and grow;Able to express yourself fluently in English and Dutch or French. WE OFFERWhat we offerReimbursement of transport costs;Daily food allowance;Invaluable professional experience at the ‘best business school in the world';A workspace where everyone feels respected, valued and free to be themselves;Inspiring and awesome colleagues;Team events such as Last Friday Drinks, team-building days and celebrations, as well as time spent on community days and charity activities;Forward-looking and very accessible leadership hosting inspirational lunches;And much more!Looking for an internship where you’ll really make a difference?Then we look forward to meeting you!

As a store replenisher you'll support the Replenishment Coordinator and you'll be responsible for the correct execution of the ordering process so that the items arrive in the stores on time. Client DetailsOur client is market leader in the cosmetics sector and is a fast-growing international company. DescriptionAs a Store Replenisher you'll be the support of the Store Replenisher Coordinator and you're tasks will consists of: Controlling the orders on punctuality, correctness, completeness and the distribution of these items to the storesReporting to the Category Management if the quantities or delivery dates agreed with the suppliersIntroduction of the desired stock level per article or subsidiary in the RPM systemFollowing-up so that items are delivered to the correct storesEnsuring that the return process is optimal an optimal and follows the rules of the companyDetermining & introducing the distribution of items such as boxes, one shots, references that are in the folder as well as liquidation references in order to optimize salesResponding to questions and comments from stores in order to find a solution to problemsProfileOur client is looking for a Store Replenisher that : Preferably is in possession of a bachelor's degreeHas a first experience in a logistics or equivalentSpeaks fluently Dutch & FrenchHas excellent communication skills, is results-oriented and has an analytical mindsetHas a good knowledge of MS Office (Excel +, Word & Outlook) Job OfferOur client offers a full-time position in a strong and dynamic international company.

FunctieomschrijvingDe Quality and Regulatory Compliance Specialist ondersteunt de eigen labeling en waarborgt kwaliteitssysteemactiviteiten.Je past deskundigheid op het gebied van regelgeving toe om de naleving van deze activiteiten te ondersteunen in overeenstemming met de EU-verordening inzake medische hulpmiddelen.Je verzamelt informatie over regelgeving en naleving van regelgeving over verschillende aspecten die van toepassing zijn. Dit houdt dagelijkse ondersteuning & monitoring in.Functie-eisenTalenkennis: Engels - elke bijkomende taal is een plusKennis MS-Office & SAPStudies: studies binnen deze materie zijn een must (technisch/wetenschappelijk)Kennis en 2-3 jaar ervaring van EU CE marking is vereistTeamplayer - onmiddellijk inzetbaarArbeidsvoorwaardenVoltijdse opdracht, 6 maanden.Competitief salaris.

Solliciteer indien:BedrijfsomschrijvingDeze internationale IT-distributeur is als onderdeel van hun groei op zoek naar een nieuw commercieel profiel. Hun specialisten met ervaring en expertise geven elke dag het beste van zichzelf voor hoogwaardige IT-oplossingen en services aan te bieden in de B2B sector. Onze klant streeft naar een humane werkomgeving waar ruimte is voor initiatief, creativiteit en persoonlijke groei. Het Internationaal karakter wordt tegelijkertijd gecombineerd met een familiair en gezellig karakter. Zij scheppen banden, zowel met onze collega's, partners als klanten.OmschrijvingJe onderhoudt bestaande relaties in jouw persoonlijk klantportfolio.Je analyseert de behoeftes van je klant en spot verkoopkansen.Je bent een innovator en denkt graag mee over hun ideale digitale veranderingsprocessenJe benadert proactief nieuwe klanten door middel van warme leads.Je werkt nauwgezet samen met je interne collega's (Sales & Marketing) en je zorgt voor een goede opvolging.Je behandelt orders en aanvragen van resellers, je biedt oplossingen en maakt offertes op maatProfiel van kandidaatJe bent Nederlandstalig met een zeer goed niveau FransJe hebt idealiter een eerste werkervaring in de salesJe hebt kennis in IT en specifiek in softwaresJe bent een echte team-palyerJe werkt innovatief en hebt een duidelijke communicatieJe bent extravert AanbodOnze klant biedt een vast en variabel salaris aan (+ extralegale voordelen). Je komt terecht in een dynamische divisie waar je creatief kan samenwerken met open minded en energieke collega's. Daarnaast krijg je de ruimte om jezelf te ontwikkelen en (internationale) doorgroeimogelijkheden. Je kan snel vooruitgang boeken aan de hand van de aangeboden sales opleidingen en technische opleidingen.

Do you know your way around the logistics and administration of clinical trials? Are you looking for a challenging opportunity at one of the biggest pharmaceutical companies? Look no further, this is the job for you!Do you believe in affordable healthcare? Are quality & safety your priority number 1? Then you'll feel comfortable in this company, who's one of the biggest pharmaceutical companies in the world.As Clinical Trial Assistant, you will be part of the Global Clinical Operations department which performs clinical studies for pharmaceutical products.You definitely need to apply if you're looking for a contract at AUSY, a project based contract or an opportunity as a freelancer, because it's all possible! Just get in contact with me: [email protected] or 03 369 19 80.Job DescriptionYou report directly to one of the Global Clinical Operations Unit HeadYou will be a member of the local clinical trial team and work closely with the Site Manager, Clinical Research Associate, the Local Trial Manager and Phase I Manager on (a) specific trial(s)You are responsible for the management of logistic and administrative tasks related to the start up, execution and closing of Phase I - IIIYou perform all duties and activities according to the current list of roles and responsibilitiesYou know and adhere to company SOPs, ICH, GCP and national regulatory requirementsYou will assist in training of company staff as requiredJob RequirementsIf you can check off each of the following skills, you're the person I'm looking for!You have a bachelor degree (business and management administration) or equal by experience.You have basic knowledge of clinical drug development and regulatory processes and procedures.You are able to keep an eye on priorities whilst working on different tasks.Your flexibility is an asset when it comes to working hours.You follow change management for internal guidelines.You know your way around a computer and different programs (MS Office).Your communication skills make sure all customer service related tasks and team collaboration runs smoothly.Your excellent knowledge of Dutch and English is a must.Your interpersonal skills, eye for detail and accuracy will convince the hiring manager to choose you as his next colleague!Salary and BenefitsAs an answer to your high performance & flexibility, AUSY offers you an interesting salary package, with some interesting extra's like:Meal vouchers of €7Net representation cost of €50Hospitalization insuranceCar + fuel card OR home-work compensation32 holidaysEnd-of-year bonusECO vouchersOpportunities to follow trainingsAnd on top of this you'll improve your skills and become an even bigger expert!

Deze beursgenoteerde multinational met een specialisatie in het design en in productie brengen van software voor microchips, is op zoek naar een ervaren .Net developer. Je zal hier terechtkomen in een hoogtechnologische omkadering, met de nodige interne kennis om je niet alleen te ondersteunen maar ook te stimuleren. Omdat IT de core business is van deze onderneming, wordt hier geïnvesteerd in de tools dat je nodig hebt om jouw werk naar behoren te kunnen uitvoeren!Jouw verantwoordelijkheden: .Net, SQL, Azure, C++, Beveiligd platform, DiegemJe merkt op basis van de opgesomde technologieën dat deze functie sterk naar de backend ontwikkeling gericht is. Daarnaast hecht men hier veel belang aan de "security" kant van de applicatie, waardoor je hier een goed oog voor moet hebben. Men verzorgt hier de volledige levenscyclus van de applicatie, van de technische analyse tot de ondersteuning!Jouw profiel: .Net, SQL, Azure, C++, Beveiligd platform, DiegemMaster in Toegepaste Informatica of Computerwetenschappen, aangevuld met minimum twee jaar professionele werkervaring binnen een .Net omgeving.Een sterk redeneringsvermogen en de wil om volledige ownerschip te nemen van het product waarop je werkt.Een ambitieuze en misschien wel internationale mindset waar je zoekt naar een functie die verschillende toekomstperspectieven kan bieden.Naast het Nederlands, ben je ook vloeiend in het Engels. Het beheersen van Frans is een pluspunt.Je zoekt een functie waar de nadruk momenteel volledig op het programmeren ligt!Ons aanbod: .Net, SQL, Azure, C++, Beveiligd platform, DiegemWerken in een internationale omkadering, waar je niet alleen de nodige tools ter beschikking hebt maar ook collega's die je waar nodig een handje komen helpen.Een puur technologische functie, waardoor je je volledig kan richten naar het perfectioneren van jouw technische vaardigheden.Een stevige bruto verloning gekoppeld aan een bedrijfswagen, tankkaart, groepsverzekering, hospitalisatieverzekering (+invaliditeitsverzekering), maaltijdcheques en onkostenvergoeding. Een onderneming dat je ook toekomstperspectieven biedt binnen ontwikkeling, maar ook daarbuiten!Hier profiteer je van flexibele werktijden, je kan je werkdag beginnen tot 10 uur. Dit geeft je de vrijheid om de ochtendspits te vermijden en eventueel andere activiteiten in de ochtend gemakkelijker te plannen. Heb je interesse in deze vacature of ken je iemand die hierin geïnteresseerd kan zijn? Aarzel dan zeker niet om Jens of Cedric van Austin Bright samen met je cv te contacteren via apply @ austinbright.com of bel ons op het nummer 02 808 33 55. We zorgen steeds voor een confidentiële behandeling van je kandidatuur.

Are you an excellent communicator with an interest in an administrative challenge for one of the biggest pharmaceutical companies in the world? Apply here!Do you believe in affordable healthcare? Are quality & safety your priority number 1? Then you'll feel comfortable in this company, who's one of the biggest pharmaceutical companies in the world.You definitely need to apply if you're looking for a contract at AUSY, a project based contract or an opportunity as a freelancer, because it's all possible! Just get in contact with me: [email protected]  or call 03 369 19 80.Respond to customer inquiries regarding BWI Product installation process and coordinates with 3rd party suppliers when applicableAnalyse and report weekly back to Management on BWI Products installation progressEnsure all activities are within Service Management System through daily updates and documentationMaintain traceability of BWI products through Daily updates and documentationCollect data and prepares routine reports for managementReview Franchise-specific Return Orders dailyTake necessary contacts with relevant parties to understand Product/Service statusSupport various project assignments through implementation as assignedJob RequirementsBachelor degree or equivalent through experience2-4 years' experience in a similar functionVery good computer skills: MS Office (Word, Excel ...)Excellent communication skills: verbal and written EnglishSalary and BenefitsAs an answer to your high performance & flexibility, AUSY offers you an interesting salary package, with some interesting extras like:Meal vouchers of €7Net representation cost of €50Hospitalization insuranceCar + unlimited fuel card OR home-work compensation32 holidaysEnd-of-year bonusPension planECO vouchersOpportunities to follow trainingsAnd on top of this you'll improve your skills and become an even bigger expert!

This pharma giant is looking for a trilingual (NL, FR, ENG) junior clinical research associate who will manage clinical study activities for multiple sites for the medical devices group.Do you believe in affordable healthcare? Are quality & safety your priority number 1? Then you'll feel comfortable in this company, who's one of the biggest pharmaceutical companies in the world.You definitely need to apply if you're looking for a contract at AUSY, a project based contract or an opportunity as a freelancer, because it's all possible! Just get in contact with me: [email protected] or call 03 369 19 80.Job DescriptionManaging clinical study activities for multiple sites in single or several clinical project for the medical devices groupFostering strong, productive relationshipsOverseeing performance of appointed study sites, conducting company initiated clinical studiesSite visits, monitoring, communication and deliverables for the assigned study sitesServe as a member of the clinical study team as the liaison between Clinical Operations and study site personnelJob RequirementsBA degree in science: Life Science, Physical Science, Nursing or Biological Science2 years' relevant experience with clinical/medical backgroundUnderstanding and application of regulations and standards applied in clinical research areas and medical devices/combination productsPrevious clinical research experience is requiredProficiency with MS Office (Word, Excel, PPT ...)Good knowledge of Dutch, French and EnglishSalary and BenefitsAs an answer to your high performance & flexibility, AUSY offers you an interesting salary package, with some interesting extras like:Meal vouchers of €7Net representation cost of €50Hospitalization insuranceCar + unlimited fuel card OR home-work compensation32 holidaysEnd-of-year bonusPension planECO vouchersOpportunities to follow trainingsAnd on top of this you'll improve your skills and become an even bigger expert!

Additional Locations:Austria:Krem an der Donau; Belgium:DiegemDiversity : Innovation : Caring : Global Collaboration : Winning Spirit : High PerformanceAt Boston Scientific, we'll give you the opportunity to harness all that's within you by working in teams of diverse and high:performing employees, tackling some of the most important health industry challenges. With access to the latest tools, information and training, we'll help you in advancing your skills and career. Here, you'll be supported in progressing : whatever your ambitions.For over 40 years, Boston Scientific has been working to improve patients lives as the worlds leading medical technology company. Every day, we tackle the healthcare industrys most important challenges with innovative products, a culture of collaboration and a deep passion for improving human life : making a career at Boston Scientific more than just a job. If you want to be a part of it and follow your calling, then we should get to know each other. To strengthen our Customer Care team, we are looking for an ambitious and motivated new colleague for a permanent position as of 01.07.2024 at the Diegem location : with a hybrid workplace model (2:3 days home office):Customer Care : Bid and Contract Coordinator (m/f/d)The Role::Independent processing and coordination of tenders, offers and contracts for our customers in Belgium and Luxembourg:Contract review and preparation in cooperation with the sales force and key account management:Advising and supporting the sales force in the implementation of pricing and contract strategies :Answering price inquiries and creating price lists :Helping to shape optimization opportunities in your own day:to:day business:Collaboration on projects in the area of price and offer management :Solution:oriented complaint management and credit note processing in cooperation with the Finance and Customer Excellence departments:Price and data maintenance as well as price reporting and analysis in SAP:Processing and documentation of business cases with internal and external customers in SalesForceYour Profile::Successfully completed commercial training and 3 years of professional experience in internal sales, customer service or price management, ideally in the area of tenders and public procurement law:Ability to work in a team, social skills, initiative, commitment and customer orientation:Quick comprehension and analytical thinking, good time management, high degree of self:organization, structured way of working:Strong communication and negotiation skills:Very good MS Office user skills, especially MS Excel and MS Word :Experience in working with an ERP system, ideally SAP R3/SD or S4/HANA, would be an asset:Experience in working with a CRM system, ideally SalesForce/ServiceCloud, would be an asset:Fluent in Dutch and French, good written and spoken English skillsOur Offer:In addition to an exciting job in a multi:award:winning company (including the Top 100 Innovators Award), highly innovative medical products and a respectful working environment in a dynamic team, we offer you a performance:related and attractive remuneration package, modern IT equipment and excellent opportunities for personal and professional development through an established talent management program in our organization. Although we are sure that you will enjoy coming to our new and modern office in Diegem, with plenty of parking spaces for stress:free parking and good public transport links, you can also benefit from the opportunity to work from home. A company pension scheme and other attractive social benefits round off the package. Above all, you will have the opportunity to become part of a corporate culture in which everyone plays their part in improving peoples lives.Do you want to become a part of Boston Scientific? Then dont hesitate

KONE recherche un technicien expérimenté dans le domaine des portes automatiques pour rejoindre notre équipe dynamique. En tant que technicien de maintenance chez KONE, vous serez responsable de votre propre portefeuille de clients, avec une tournée attribuée à Bruxelles . Vous établirez votre propre planning mensuel pour garantir que tous les travaux nécessaires soient effectués à temps, selon des normes élevées et en toute sécurité. En tant que premier point de contact pour les clients et utilisateurs finaux, vous les informerez de manière proactive. Chez KONE, l'ennui n'a pas sa place. Nous proposons une large gamme de portes et assurons également la maintenance, les réparations et les pannes d'autres portes que celles de KONE, offrant ainsi des défis techniques variés. Nous offrons un programme de formation complet, comprenant des formations internes et un coaching sur le terrain assuré par des collègues expérimentés. Sur le terrain, vous pourrez toujours compter sur le soutien de vos collègues, de l'expert technique, du coach de terrain ou de votre superviseur pour résoudre les problèmes éventuels. KONE a une culture d'entreprise familiale encourageant le perfectionnement personnel. En fonction de vos intérêts et de vos compétences, KONE offre plusieurs possibilités de carrière. Vous pouvez travailler comme technicien dans l'un de nos autres départements (Installation, Modernisation, Escalators ou Ascenseurs ), devenir expert technique pour votre région, relever un défi en tant que superviseur ou rejoindre nos services centraux. Profil Recherché : Bonnes connaissances en électromécanique acquises par des études ou une expérience professionnelle Bonne connaissance des portes industrielles, portes piétonnes coulissantes et battantes Orienté client avec un fort accent sur la sécurité Affinité technique et désir constant d'élargir vos connaissances Disponible pour être de garde (une fois toutes les 6 à 8 semaines) Maîtrise du français et détenteur d'un permis de conduire B Ce que nous vous offrons : Il s'agit d'une excellente opportunité pour les techniciens expérimentés et les jeunes diplômés de rejoindre une entreprise dynamique. Vous bénéficierez à la fois des avantages d'une petite organisation locale dans la région et des avantages d'une organisation internationale et performante. Nous encourageons nos employés à se perfectionner et leur offrons de nombreuses possibilités de carrière. En 2023, KONE Belgique a obtenu le certificat Top Employer pour la 7e année consécutive ! Nous offrons un salaire attractif dans une entreprise internationale, financièrement stable et en pleine croissance. En outre, vous bénéficiez de divers avantages extra-légaux (utilisation privée d'une camionnette, indemnités nettes, chèques-repas, assurance groupe & hospitalisation, etc.) Read more on

Key Roles and Responsibilities: Responsible for sustainable top-line growth, KPI’d in Annual Contract Value Gross Profit, across the clustered countries Overall Cloud Go-To-Market strategy for assigned the cluster including coordination of marketing resources and campaigns Sales management of all Client Partners Assignment of targets and sales territories Creation of channels to market for the cluster of country including the NTT sales teams, partner channels and marketing led Effective interworking with the EU pre-sales team and leadership for the execution of winning business Execution and governance of sales pipeline and tracking in Salesforce.com and other tools including weekly pipeline updates Direct selling - leverage depth of relevant market/industry connections to interface directly with CIOs / CTOs and other non-technical Leaders. Foster excellent C-suite / Senior stakeholder relationships with new potential clients to NTT Ltd through fully understanding the client and the industry in which they operate. Access new markets, both from within an allocated geographical territory and from an industry perspective. Help the team craft all commercial constructs, helping negotiate and construct complex, multi-year deals to ensure win/win solutions for both the client and NTT Oversee the end-to-end scope of the client project and bring in the relevant NTT Data stakeholders at the right point of the conversation to close the deal. Knowledge, Skills and Attributes: Multi-language capabilities Proven sales leadership experience within the Belgian, Dutch, French and Luxembourg markets Excellent leadership skills and ability to think at a tactical strategy level. Has executive presence; is a highly seasoned sales leader and able to engage and build relationships with any audience internally or externally Has a client centricity and a solution-based sales mindset. Key business financial skills. Demonstrable ability to perform a cost-benefit analysis and manage the budget of a team. Strong business negotiation skills, influence, conflict resolution, and political savvy Demonstrate excellent presentation skills, are innovative, and have a formidable client orientation aptitude Resourceful and confidently handles pressure in critical situations, ensuring at all times that client requirements are met Have knowledge in the services industry, service delivery models, process improvements, consumption models and all CSD portfolio offers. Has a depth of relevant connections and the background connections and ability to interface directly with both CIOs / CTOs and non-technical Leaders. Academic Qualifications and Certifications: Relevant tertiary or post graduate degree Required Experience: Significant relevant experience in similar role within a related environment Significant previous experience managing a sales team across a large geography Demonstrable experience dealing with clients and engaging to influence sales Significant demonstrable experience in the sales leadership role Significant strategic and operational planning experience Skills Summary Client Engagement Management, Client Relationship Management, Customer Engagement, Engagement Management, Managing Sales Teams, Organizational Strategy, Prioritization, Strategic Objectives, Strategic Operations, Strategy Plan What will make you a good fit for the role? Workplace type: Hybrid Working Equal Opportunity Employer NTT is proud to be an Equal Opportunity Employer with a global culture that embraces diversity. We are committed to providing an environment free of unfair discrimination and harassment. We do not discriminate based on age, race, color, sex, religion, national origin, disability, pregnancy, marital status, sexual orientation, gender reassignment, veteran status, or other protected category